mCEACAM20-IgC2-1.pdb

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
74004CompleteStructure prediction ganlmCEACAM20-IgC2-1.pdb904 May 20213 Jun 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
   sequence: PLAKLTLTVNQSTVTEQREMAVFYCNTNADNITIHWVSNNSLLVLNERMKLSADNKTLTILIVQREDSGSYLCEVQHGFEVQRSNTASLT
   disopred: ------------------------------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------------------------
| Download | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
7198911n/acomparative modeling1-90904 May 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington