DYSF_1151_1278

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
81590CompleteStructure prediction matthedoDYSF_1151_127812811 Jun 202111 Jul 2021
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .   
   sequence: RYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWDQTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLERMPRLAWFPLTRGSQPSGELLASFELIQ
   disopred: --------------------------------------------------------------------------------------------------------------------------------
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
79460110.85TrRefineRosetta1-12812811 Jun 2021



Baker Lab | Rosetta@home | Contact | Terms of Service
©2021 University of Washington