2021-08-21_00000149_1_19 Domain 8 Parse 1 Confidence: 0.21
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 114278 | Complete | Structure prediction | RoseTTAFold | 2021-08-21_00000149_1_19 | 1496 | 21 Aug 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 110948 | 8 | 1 | 0.21 | comparative modeling | 797-863 | 67 | 22 Aug 2021 |
>110948
LYFHTDDFAEVLDRAKRHNSTLMAWFLLNREDSDARNYYYWEIPQHYVFNNSLWTKRRKGGNKVLGR
>1sg7A_306 weight: 1.0000 score: 6.79 eval: n/a prob: n/a identity: 0.1194 startpos: 2
YKTKSDLPESVKHVLPShqDIYKEAFNSAWdeETAHKVAWAAVKHEYAKgdDKWHKKS---------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington