2021-10-23_00000171_1_11 Domain 2 Parse 1 Confidence: 0.07
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
142574 | Complete | Structure prediction | cameo | 2021-10-23_00000171_1_11 | 1154 | 23 Oct 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
138914 | 2 | 1 | 0.07 | comparative modeling | 1091-1154 | 64 | 23 Oct 2021 |
>138914
DVSEEEDFRLACRHERYPTRHQPHMGDSWPRSSAHEAAELNRQCWVLGHWVGTGGLVPRGSAAA
>1jdqA_201 weight: 1.0000 score: 18.95 eval: 300 prob: 23.14 identity: 0.1094 startpos: 20
MAKYQVTKTLDVRGEVCPVprnMKPGEitVKKLGHEV---------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington