2021-11-13_00000175_1_19 Domain 17 Parse 1 Confidence: 0.05
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
150144 | Error | Structure prediction | RoseTTAFold | 2021-11-13_00000175_1_19 | 2839 | 13 Nov 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
147768 | 17 | 1 | 0.05 | comparative modeling | 2477-2604 | 128 | 17 Nov 2021 |
>147768
PIHHGDPSYRTLKETQPWSSPKGSEGYLAATYPTVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRISSSQQHPHLRKVSVSESNVL
>1ytrA_201 weight: 1.0000 score: 17.52 eval: 490 prob: 18.47 identity: 0.0547 startpos: 2
------------------------------------------SSAYSLQMGATAIKQVKKLFKKW-GW------------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington