SSGCID - MygeA.19951.a Uncharacterized ABC transporter permease MG064 MG_064 Domain 1 Parse 1 Confidence: 0.53
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 13992 | Domain complete | Structure prediction | ssgcid | SSGCID - MygeA.19951.a Un... | 1331 | 15 Jan 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 14857 | 1 | 1 | 0.53 | comparative modeling | 1-65 | 65 | 29 Jan 2020 |
>14857
MLNLIKNVIRSLKSAKIALIALTFLIFVAVGGFVLLNNTVNNFNAAFNYVTHTGKLSNAIINERY
>6q6bA_w003 weight: 0.5061 score: 0.02910 eval: n/a prob: n/a identity: 0.0308 startpos: 34
--ACTACADACLADLTKCIRTDMDCADVCATVCAACGDECARHAGMHEHCRVCAACRSCEQAC--
>6qvhA_w002 weight: 0.4939 score: 0.02633 eval: n/a prob: n/a identity: 0.0308 startpos: 27
--ACTACADACLADLTKCIRTDMDCADVCATVCAACGDECARHAGMHEACRCAEACRSCEQAC--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington