T9999s1 Domain 3 Parse 1 Confidence: 0.19
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
116 | Complete | Structure prediction | casp | T9999s1 | 285 | 21 Apr 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
163 | 3 | 1 | 0.19 | comparative modeling | 161-193 | 33 | 22 Apr 2018 |
>163
KNIGAVNTRINIANSTTRYTPMRQTGQPVSAGF
>3j6bV_307 weight: 1.0000 score: 6.77 eval: n/a prob: n/a identity: 0.0303 startpos: 21
AIYHQFNVKMELSDGSVVIRRSQYPKGEIRLIQ
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington