T0956 Domain 2 Parse 1 Confidence: 0.08
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 164 | Complete | Structure prediction | casp | T0956 | 178 | 8 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 241 | 2 | 1 | 0.08 | comparative modeling | 124-178 | 55 | 8 May 2018 |
>241
QTIPGHSEPRSMTDNGIYHSDSPFFQIALGHALLGTGKIYDHITRALRVAPITIA
>4ln0C_201 weight: 1.0000 score: 27.23 eval: 1.6 prob: 83.57 identity: 0.2000 startpos: 9
--------RRSLGKN--YKEPEP-----APNSVSITGSVDDHFAKALGDT-----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington