T1033 Domain 1 Parse 1 Confidence: 0.08
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
27277 | Complete | Structure prediction | casp | T1033 | 100 | 26 May 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
26405 | 1 | 1 | 0.08 | comparative modeling | 1-100 | 100 | 26 May 2020 |
>26405
EFDSFTSPDLTNEIKEITDQLSYYIYNKHFSSDFEQVEGAKLNIQNEISQFVKEGKAPVQAAYNKLQDPDIKDLLDYYDNIEKHSDEFESEIVKFFSEKK
>4l8iB_301 weight: 0.4717 score: 6.6 eval: n/a prob: n/a identity: 0.1500 startpos: 1
----GSMSDIRKDLEERFDKLVEALKNKvdQFHEERMKDWFKDLRKEVEQMRRAVRNYASEALSKINDltNDDKKLASNDVLKLVAEVWKKLEAILADVE
>5gofA_101 weight: 0.4327 score: 65.23 eval: 0.012 prob: n/a identity: 0.0900 startpos: 291
-------HARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVNLAAEDKRHYSaiDQLEKIQNNSKLLRNKAVQLENELENFTKQFL
>5goeA_102 weight: 0.0160 score: 64.21 eval: 0.014 prob: n/a identity: 0.0900 startpos: 286
-------HARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVNLAAEDKRHYSaiDQLEKIQNNSKLLRNKAVQLENELENFTKQFL
>5wp3B_303 weight: 0.0142 score: 6.07 eval: n/a prob: n/a identity: 0.1200 startpos: 1
------INEIKKNAQERMDETVEQLKNesKVGTEERRLELAKQVVFAANRALIRVRTIALEAAWRLLMLGKRDISQALEEIEKLTKVAAKKIKEVLEAKI
>5gomB_103 weight: 0.0123 score: 64.2 eval: 0.014 prob: n/a identity: 0.0900 startpos: 305
-------HARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVNLAAEDKRHYSaiDQLEKIQNNSKLLRNKAVQLENELENFTKQFL
>4oydB_304 weight: 0.0113 score: 6.06 eval: n/a prob: n/a identity: 0.1000 startpos: 5
KVLDKAKDQAENRVRELKQKLEELYKEArlTQeeLRYIAAMLMAIGDIYNAIRQAKQEADKLKKavNSQQLDELKRRLEELKEEASRKARDYGREFQLKL
>6ds9A_305 weight: 0.0091 score: 6.01 eval: n/a prob: n/a identity: 0.1000 startpos: 1
----GSWAEFKQRLAAIKTRLAAIKTRLQALG---GSEAELAAFEKEIAAFESEIAAFESELQAYKGKGN-PEVEALRKEAAAIRDEAAAIRDELQAYRH
>5yewA_105 weight: 0.0081 score: 63.05 eval: 0.015 prob: n/a identity: 0.1200 startpos: 299
-------HARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDS----VNLAAEDleIDQLEKIQNNSKLLRNKAVQLENELENFTKQFL
>4l8iA_306 weight: 0.0075 score: 5.99 eval: n/a prob: n/a identity: 0.1800 startpos: 1
-----SMSDIRKDLEERFDKLVEALKNkkMKAAfeRMKDWFKDLRKEVEQMRRAVRNYASEALSKINDLPinDVLKLVAEVWKKLEAILADVEAWFTHHH
>5jsbB_307 weight: 0.0063 score: 5.84 eval: n/a prob: n/a identity: 0.1400 startpos: 7
DKAKDQAENRVRELKQVLEELYKEARKLDLTQeiERYAAAIIRAIGDINNAIYQAKQEAEKLKKavNSQQLDELLRRLDELQKEASRKANEYGREFELKL
>6egcA_108 weight: 0.0057 score: 61.4 eval: 0.017 prob: n/a identity: 0.1200 startpos: 16
-------EELAKRLKELLRELERLQREGSSDEDVRELLREIKELVEEIEKLARE----QKYLVEEL-nEIIRELERSLREQEELAKRLKELLRELERLQR
>5gnrA_110 weight: 0.0051 score: 60.54 eval: 0.019 prob: n/a identity: 0.1100 startpos: 292
-------HARLQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDS----VNLAAEDG-iDQLEKIQNNSKLLRNKAVQLENELENFTKQFL
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington