T0963 Domain 1 Parse 1 Confidence: 0.06
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 193 | Complete | Structure prediction | casp | T0963 | 372 | 15 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 289 | 1 | 1 | 0.06 | comparative modeling | 1-151 | 151 | 15 May 2018 |
>289
SGSVTAGMALAATDIPGLDASKLVSGVLAEQRLPVFARGLATAVSNSSDPNTATVPLMLTNHANGPVAGRYFYIQSMFYPDQNGNASQIATSYNATSEMYVRVSYAANPSIREWLPWQRCDIGGSFTKEADGELPGGVNLDSMVTSGWWSQ
>1sghB_201 weight: 1.0000 score: 21.1 eval: 25 prob: 49.24 identity: 0.0265 startpos: 19
----------SSKRAPQMDWSKKNE-LFS--------------------------------------------------------------------------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington