T1062 Domain 1 Parse 1 Confidence: 0.36
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 29818 | Complete | Structure prediction | casp | T1062 | 35 | 19 Jun 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 29203 | 1 | 1 | 0.36 | comparative modeling | 1-35 | 35 | 19 Jun 2020 |
>29203
ASFRDFASNNSTAFRDAVELALNENGTTLKSLGNS
>m0toA_301 weight: 1.0000 score: 7.47 eval: n/a prob: n/a identity: 0.0857 startpos: 2
DKAKDFLDKHDEQVDKLLDKAGEQVDRRTGGKYSD
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington