T1096 Domain 1 Parse 1 Confidence: 0.13
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 33418 | Complete | Structure prediction | casp | T1096 | 464 | 27 Jul 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 32515 | 1 | 1 | 0.13 | comparative modeling | 1-116 | 116 | 27 Jul 2020 |
>32515
MDILENYVSFDEQARDINIAFDKLFGRDDISHMNNFSINKRSYYNCLDQISDDLNLVLNKYNDLAYSLLEIRYNMATKENYTHMEFYSDIERLFIKNEKLLNVISDIVEEEYDLDL
>m148A_301 weight: 1.0000 score: 4.75 eval: n/a prob: n/a identity: 0.1034 startpos: 3
AYIKKNLEEARQKMVRLRKALFQA---KSIQMFKQNAEMLRIVRRIYLLTKKeaERFFYQTLDSVVELTEKYAFLSSHPKKslSMSLSETRITLTELTKRLEEDLTQAMGDEIDEL
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington