T1099 Domain 2 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 33710 | Complete | Structure prediction | casp | T1099 | 262 | 30 Jul 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 32824 | 2 | 1 | 0.33 | comparative modeling | 199-262 | 64 | 30 Jul 2020 |
>32824
GRKTTTGTRKPRGLEPRRRKVKTTVVYGRRRSKSRERRAPTPQRAGSPLPRSSSSHHRSPSPRK
>1dgi4_301 weight: 0.5203 score: 7.9 eval: n/a prob: n/a identity: 0.0938 startpos: 1
---GAQVSSQKVGAHENSSTINYTTiyRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN-
>1dgi4_101 weight: 0.4797 score: 7.9 eval: n/a prob: n/a identity: 0.0938 startpos: 1
---GAQVSSQKVGAHENSSTINYTTiyRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington