2022-07-02_00000191_1_19 Domain 6 Parse 1 Confidence: 0.09
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 355921 | Complete | Structure prediction | RoseTTAFold | 2022-07-02_00000191_1_19 | 1187 | 2 Jul 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 361451 | 6 | 1 | 0.09 | comparative modeling | 882-943 | 62 | 11 Jul 2022 |
>361451
QTREMTFLAHGINHIAYDPRSWMKTLTAVRGRAPTSFLLWVVLIESSIVLALSKFFGESFDL
>2b88A_301 weight: 0.9708 score: 6.95 eval: n/a prob: n/a identity: 0.0645 startpos: 5
FNKELGWATWEIFNlnLNGVQVKAFIDSLRDDPSQ---------SANLLAEAKKLNDAQAPK
>1bdcA_303 weight: 0.0292 score: 5.52 eval: n/a prob: n/a identity: 0.0645 startpos: 6
FNKEQQNAFYEILHlnLNEEQRNGFIQSLKDDPSQ---------SANLLAEAKKLNDAQAPK
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington