T0971 Domain 1 Parse 1 Confidence: 0.84
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 244 | Complete | Structure prediction | casp | T0971 | 186 | 23 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 375 | 1 | 1 | 0.84 | comparative modeling | 39-186 | 148 | 23 May 2018 |
>375
SPNPSDSPNPSDSPNPPASPNIEAILASYAGFRDRDIEGILSGMHPDVEWVHPEGMGKYGLGGTKLGHAGIKEFLAHVPTVLGGMRLAPREFIEQGDRVVVFGTREVTSLRGTTATLDFVHSWTMRDGKATRMEDIFDTVAFHELIES
>3ebtA_201 weight: 0.3598 score: 149.23 eval: 4.8e-25 prob: 99.93 identity: 0.4459 startpos: 1
-----------------MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENGRAVTFEDHFDTAEMIRLITA
>3ebtA_101 weight: 0.3238 score: 136.3 eval: 1.9e-07 prob: n/a identity: 0.4459 startpos: 1
-----------------MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENGRAVTFEDHFDTAEMIRLITA
>3ebtA_301 weight: 0.3164 score: 15.87 eval: n/a prob: n/a identity: 0.4459 startpos: 1
-----------------MSNNMQTVRESYEAFHRRDLPGVLAALAPDVRWTHPDGMSPYGLGGTKHGHDEVIAFIRHVPTHIAEMRLAPDEFIESGERIVVLGTRRVTAVNGRSATLKFVHVWRFENGRAVTFEDHFDTAEMIRLITA
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington