2022-07-30_00000247_1_11 Domain 2 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 385924 | Complete | Structure prediction | cameo | 2022-07-30_00000247_1_11 | 1956 | 30 Jul 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 381510 | 2 | 1 | 0.33 | comparative modeling | 1874-1956 | 83 | 31 Jul 2022 |
>381510
SNTPCVPRAEEEAASLPDEGFVAFTANENCVLPDKSETASATSFPPSYESVTRGLSDRVNMRTSSSIQNEDEATSMELIAPGP
>4adiA_201 weight: 1.0000 score: 24.05 eval: 780 prob: 14.05 identity: 0.2169 startpos: 182
--PfnTPHGQLEVQVPPDPglVEYIMNqnCHGPDWASPVCQRHS-PDCSRLVGATPERPRLRLVD------ADDPLLRTAPGP
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington