2022-09-10_00000002_2_19 Domain 7 Parse 1 Confidence: 0.15
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
409037 | Complete | Structure prediction | RoseTTAFold | 2022-09-10_00000002_2_19 | 1817 | 10 Sep 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
404369 | 7 | 1 | 0.15 | comparative modeling | 922-1020 | 99 | 11 Sep 2022 |
>404369
LNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLDTMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
>1xtcD_201 weight: 1.0000 score: 26.26 eval: 58 prob: 39.05 identity: 0.1515 startpos: 1
-----TPQN------ITDLcqIYTLNDKIFSYTESLAGKREmfKNGAIFQVEVPSSQHIDSQ----KKAIERMKDTllTEAKVEK--------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington