2022-09-10_00000002_2_19 Domain 9 Parse 1 Confidence: 0.93
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
409037 | Complete | Structure prediction | RoseTTAFold | 2022-09-10_00000002_2_19 | 1817 | 10 Sep 2022 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
404371 | 9 | 1 | 0.93 | comparative modeling | 1769-1817 | 49 | 11 Sep 2022 |
>404371
SDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
>7r5kM0_101 weight: 0.4867 score: 36.51 eval: 0.01 prob: n/a identity: 0.9796 startpos: 626
-DSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
>7r5kM0_201 weight: 0.4758 score: 82.51 eval: 2.9e-09 prob: 98.94 identity: 1.0000 startpos: 625
SDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL
>7wb4g_102 weight: 0.0172 score: 31.24 eval: 0.025 prob: n/a identity: 0.7143 startpos: 626
-MSDSSEPRVPLRLLAPHIGRLPMPEDYALEELRGLTQSYLRELICDS-
>7tdzF_103 weight: 0.0127 score: 30.25 eval: 0.03 prob: n/a identity: 0.7143 startpos: 593
-MSDSSEPRVPLRLLAPHIGRLPMPEDYALEELRGLTQSYLRELICDS-
>5k3gC_110 weight: 0.0050 score: 27.66 eval: 0.047 prob: n/a identity: 0.0612 startpos: 503
---------FIVEAFARRVNEIGD--ITIKEALSDLLHLHVNYELLDVA
>7wb4g_203 weight: 0.0025 score: 177.67 eval: 1.6e-30 prob: 99.86 identity: 0.7347 startpos: 625
SMSDSSEPRVPLRLLAPHIGRLPMPEDYALEELRGLTQSYLRELICDS-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington