T0960_segment Domain 1 Parse 1 Confidence: 0.02
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 277 | Complete | Structure prediction | casp | T0960_segment | 79 | 30 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 418 | 1 | 1 | 0.02 | comparative modeling | 1-79 | 79 | 30 May 2018 |
>418
QNWDDGNFDPASYLPKAGFTWAALPGKPATFPPSGHNHDTSQITSGILPLARGGLGANTAAGARNNIGAGVPATASRAL
>1zugA_w007 weight: 1.0000 score: 0.09306 eval: n/a prob: n/a identity: 0.0633 startpos: 5
----------SERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQY----------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington