2023-01-14_00000292_1_19 Domain 3 Parse 1 Confidence: 0.03
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
479330 | Error | Structure prediction | RoseTTAFold | 2023-01-14_00000292_1_19 | 1402 | 14 Jan 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
479888 | 3 | 1 | 0.03 | comparative modeling | 1168-1228 | 61 | 9 Feb 2023 |
>479888
YQAQSDVPQEVCDQILEAAKESSVGEDGVRSQVKIRKPNGKNNIRYEYDLDHIDCKKNEIT
>m05pA_201 weight: 1.0000 score: 18.86 eval: 870 prob: 7.14 identity: 0.0492 startpos: 136
-------------EKYeiDRKEQIFHidNFPRItrDLIEGVGDVQYSVNISTCIPFNI---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington