2023-04-22_00000083_1_19 Domain 5 Parse 1 Confidence: 0.32
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
509670 | Complete | Structure prediction | RoseTTAFold | 2023-04-22_00000083_1_19 | 1173 | 22 Apr 2023 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
504629 | 5 | 1 | 0.32 | comparative modeling | 975-1039 | 65 | 22 Apr 2023 |
>504629
PYAPALTLKQLESITSKQELDKLTQSIPISLSKSDVKVIDYYNKIQKNYNLPAYNSTPMRKAYAV
>4c6gB_101 weight: 0.8823 score: 25.62 eval: 0.025 prob: n/a identity: 0.0615 startpos: 25
---TPITVAHVAALAR--------hDVKVALEACRARVETCSSWVQRKAE---------------
>4c6gA_102 weight: 0.0327 score: 25.1 eval: 0.028 prob: n/a identity: 0.0615 startpos: 26
----PITVAHVAALAR--------hDVKVALEACRARVETCSSWVQRKA----------------
>4c6gC_103 weight: 0.0251 score: 24.77 eval: 0.03 prob: n/a identity: 0.0615 startpos: 25
---TPITVAHVAALAR--------hDVKVALEACRARVETCSSWVQRKAE---------------
>4c6gD_106 weight: 0.0142 score: 24.32 eval: 0.033 prob: n/a identity: 0.0615 startpos: 26
----PITVAHVAALAR--------hDVKVALEACRARVETCSSWVQRKAED--------------
>4cq5C_107 weight: 0.0127 score: 24.07 eval: 0.035 prob: n/a identity: 0.0615 startpos: 25
---TPITVAHVAALAR--------hDVKVALEACRARVETCSSWVQRKAE---------------
>6v6hA_108 weight: 0.0116 score: 24.05 eval: 0.035 prob: n/a identity: 0.1231 startpos: 8
---CSLTPDVLYALGY--------kGATIEISdaVARITAARAVIDKIVN---------------
>6v6hC_109 weight: 0.0109 score: 24.03 eval: 0.035 prob: n/a identity: 0.1231 startpos: 8
---CSLTPDVLYALGY--------kGATIEIseAVARITAARAVIDKIVN---------------
>6v6hD_110 weight: 0.0105 score: 24.02 eval: 0.035 prob: n/a identity: 0.1231 startpos: 8
---CSLTPDVLYALGY--------kGATIEISdaVARITAARAVIDKIVN---------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington