2023-04-22_00000043_1_19 Domain 3 Parse 1 Confidence: 0.16
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 509662 | Complete | Structure prediction | RoseTTAFold | 2023-04-22_00000043_1_19 | 1507 | 22 Apr 2023 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 504665 | 3 | 1 | 0.16 | comparative modeling | 426-481 | 56 | 22 Apr 2023 |
>504665
VVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQS
>6iteO_201 weight: 1.0000 score: 22.17 eval: 470 prob: 17.7 identity: 0.1071 startpos: 193
-LDGPHrgDLRRARAGAANIVPNSTGAAKAIGLVIPenGKLDGAAQ----------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington