2024-03-09_00000226_1_19 Domain 2 Parse 1 Confidence: 0.41
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 601020 | Complete | Structure prediction | RoseTTAFold | 2024-03-09_00000226_1_19 | 1937 | 9 Mar 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 595338 | 2 | 1 | 0.41 | comparative modeling | 1511-1553 | 43 | 10 Mar 2024 |
>595338
KFTAEHWAKIVGAFCELFERTTAYQLFSATTINSTASLSPPPS
>1jhgA_201 weight: 0.5821 score: 18.79 eval: 180 prob: 48.32 identity: 0.0698 startpos: 6
EQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDERE------
>6jccA_304 weight: 0.4179 score: 6.56 eval: n/a prob: n/a identity: 0.0698 startpos: 3
HMTPEQREFLLEILAEIIANLDPTKILEEPLRRGLLTPAELQE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington