2024-03-16_00000126_1_19 Domain 1 Parse 1 Confidence: 0.28
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
602979 | Error | Structure prediction | RoseTTAFold | 2024-03-16_00000126_1_19 | 2818 | 16 Mar 2024 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
597441 | 1 | 1 | 0.28 | comparative modeling | 1-58 | 58 | 17 Mar 2024 |
>597441
MSFHITPTAAARDSETKQIDHNDSIRASYMTIEELHDAGAALSRDGADSLPGFMEFDF
>2p09A_307 weight: 0.9539 score: 6.08 eval: n/a prob: n/a identity: 0.1379 startpos: 9
WLKRIYRVRPCVKCKVAPRdkNKHLRIYNM----CKTCFNNSIDIGDDTYHGHVDWLM
>1uw1A_310 weight: 0.0461 score: 5.95 eval: n/a prob: n/a identity: 0.1207 startpos: 7
WLKRIYRVRPCVKCKVAPRnkNKHLRIYNM----CKTCFNNSIDIGDDTYHGHDDWLM
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington