2024-05-11_00000235_1_19 Domain 2 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 616937 | Complete | Structure prediction | RoseTTAFold | 2024-05-11_00000235_1_19 | 1007 | 11 May 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 611149 | 2 | 1 | 0.07 | comparative modeling | 914-1007 | 94 | 12 May 2024 |
>611149
DPKAHPFWEHNAAEWFSLHRHLVVDFPKVECWENVTKAFLTNDTTVLSAYPPNMGNDVFVMPIEEFLRDYNSTICVPFSSGFFGQDPQNSDIQH
>1sbqA_201 weight: 1.0000 score: 24.29 eval: 160 prob: 30.22 identity: 0.0851 startpos: 7
----------RKQILQKR--MALSTIEKskINQKLVAFLtkPCIKTIALYEP-IKNEVTFVDFFFEFLKINQIrvYPKveIIFID-QETNT---
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington