2024-07-27_00000166_1_11 Domain 1 Parse 1 Confidence: 0.15
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 626923 | Complete | Structure prediction | cameo | 2024-07-27_00000166_1_11 | 1241 | 27 Jul 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 622734 | 1 | 1 | 0.15 | comparative modeling | 1-64 | 64 | 16 Aug 2024 |
>622734
MANGVIPPPGGASPLPQVRVPLEEPPLSPDVEEEDDDLGKTLAVSRFGDLISKPPAWDPEKPSR
>6w09Q_301 weight: 1.0000 score: 8.62 eval: n/a prob: n/a identity: 0.1875 startpos: 1
---------PVMCLLANTTFPCSQPPCTPCCYEKEP--EKTLRMLeyYQLLQASLTCSPRRQRR
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington