2024-07-20_00000024_1_11 Domain 10 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 626425 | Complete | Structure prediction | cameo | 2024-07-20_00000024_1_11 | 1495 | 20 Jul 2024 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 622770 | 10 | 1 | 0.07 | comparative modeling | 1377-1495 | 119 | 16 Aug 2024 |
>622770
NQRYPENKEKRSKEDKEIHNKYTEREVSTKEDKPIQCTPQKAKPMRAAADLGREKILRPPVEKWKRQDDKDLREKRCFICGREGHIKKECPQFKGSSGSLSSKYMTQGKASAKRTQQES
>5udzA_201 weight: 1.0000 score: 43.59 eval: 5.3e-06 prob: 93.87 identity: 0.1681 startpos: 36
-----------PPVDVFVHQshMEGFRSLKEGEAVEFTFKKSagLESIRVTGPGGVFCIGSERRP------KGGDRCYNCGGLDHHAKECKLPPQP----K-KCHFCQSISHMVA----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington