IRX3_ring finger_1weo.pdb Domain 1 Parse 1 Confidence: n/a
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
640968 | Complete | Structure prediction | slc1916 | IRX3_ring finger_1weo.pdb | 55 | 9 Nov 2024 | 24 Dec 2024 |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
634561 | 1 | 1 | n/a | comparative modeling | 1-55 | 55 | 9 Nov 2024 |
>634561
MESAAAQACAACGDDARAACRACSYALCRACLDEDAAEGRTTCARCGGDYAAIDS
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.3818 startpos: 1
GSSGSSQFCEICGDDLFVACNECGFPACRPCYEYERREGTQNCPQCKTRYKRIDS
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington