T1007 Domain 1 Parse 1 Confidence: 0.33
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
446 | Complete | Structure prediction | casp | T1007 | 149 | 2 Jul 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
640 | 1 | 1 | 0.33 | comparative modeling | 21-149 | 129 | 3 Jul 2018 |
>640
APAHQVPVKTKGKHVFPEQETEKVWDTRALEPLEKDNQLGPLLPEPKQKPAAAEEKRPDAMTWVETEDILSHLRSPLQGPELDLDSIDHPMSDDVQDEEVPQSRPILYRQVLQGPEEDLDHLAHSMEDS
>1nynA_201 weight: 1.0000 score: 17.7 eval: n/a prob: 4.6 identity: 0.0310 startpos: 42
VELFEVFTPqrGagAASKAQVENEFGKGkelILRNGKPNST---------TSSLKTKGgtKAY------------------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington