T1011 Domain 1 Parse 1 Confidence: 0.51
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
451 | Complete | Structure prediction | casp | T1011 | 534 | 6 Jul 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
647 | 1 | 1 | 0.51 | comparative modeling | 1-47 | 47 | 6 Jul 2018 |
>647
DYKDDDDGAPKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLT
>1h20A_301 weight: 0.5216 score: 9.25 eval: n/a prob: n/a identity: 0.1702 startpos: 2
QHADPICNKPCKTHDDCSGAWFCQACWNSA-RTCGPYVG--------
>1h20A_101 weight: 0.4784 score: 9.25 eval: n/a prob: n/a identity: 0.1702 startpos: 2
QHADPICNKPCKTHDDCSGAWFCQACWNSA-RTCGPYVG--------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington