T1015s1 Domain 1 Parse 1 Confidence: 0.22
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
474 | Complete | Structure prediction | casp | T1015s1 | 89 | 10 Jul 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
679 | 1 | 1 | 0.22 | comparative modeling | 1-89 | 89 | 10 Jul 2018 |
>679
MAKFACKCGYVINLIASPGGDEWRLIPEKTLEDIVDLLDGGEAVDGERFYETLRGKEITVYRCPSCGRLHLEEAGRNKFVTYVKECGEL
>m462A_201 weight: 1.0000 score: 39.04 eval: 0.004 prob: 97.27 identity: 0.1685 startpos: 6
IEKVTCpcHHEGDFE------LWDSINTA---------------LDPEMKEKVLNQSIFLYTCPSCGEtlYHQMEDLVMIYLVPESEVK
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington