2Y9X Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 695555 | Complete | Structure prediction | orgchemist | 2Y9X | 38 | 2 Dec 2025 | 16 Jan 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 686324 | 1 | 1 | n/a | comparative modeling | 1-38 | 38 | 2 Dec 2025 |
>686324
PTDDATDDYRLKFVRLSEYVLTDINLCVNQQATRFVDC
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.3947 startpos: 1
STSDAAKDLRQPFVEITDYNGTKIEVCMNREATMYPDF
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington