CTLA-4.pdb Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 698849 | Complete | Structure prediction | sofia.balti | CTLA-4.pdb | 127 | 12 Jan 2026 | 26 Feb 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 689297 | 1 | 1 | n/a | comparative modeling | 1-127 | 127 | 12 Jan 2026 |
>689297
MKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.9055 startpos: 1
-KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTF----ICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDP-------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington