8P6Q.pdb Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 699159 | Complete | Structure prediction | MVAB | 8P6Q.pdb | 45 | 15 Jan 2026 | 1 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 689591 | 1 | 1 | n/a | comparative modeling | 1-45 | 45 | 15 Jan 2026 |
>689591
SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 1.0000 startpos: 1
SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington