5DOM A Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 700663 | Complete | Structure prediction | prg98 | 5DOM A | 122 | 2 Feb 2026 | 19 Mar 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 691000 | 1 | 1 | n/a | comparative modeling | 1-122 | 122 | 2 Feb 2026 |
>691000
QQQRCRHQFQTQQRLRACQRVIRRWSQGGGPMEDVEDEIDETDEIEEVVEPDQARRPPTLQRCCRQLRNVSPFCRCPSLRQAVQSAQQQQGQVGPQQVGHMYRVASRIPAICNLQPMRCPFR
>user1_w100 weight: 1.0000 score: 0.0 eval: n/a prob: n/a identity: 0.7377 startpos: 1
---RCRHQFQTQQRLRACQRVIRRWSQ-----------------------------PPTLQRCCRQLRNVSPFCRCPSLRQAVQSAQQQQGQVGPQQVGHMYRVASRIPAICNLQPMRCPFR
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington