6GB1.pdb Domain 1 Parse 1 Confidence: n/a
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 703073 | Complete | Structure prediction | clerif | 6GB1.pdb | 39 | 18 Apr 2026 | 2 Jun 2026 |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 693025 | 1 | 1 | n/a | comparative modeling | 1-39 | 39 | 18 Apr 2026 |
>693025
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
>user1_w100 weight: 0.3333 score: 0.0 eval: n/a prob: n/a identity: 0.3590 startpos: 1
Y-EGTFTSDYSIYLDKQAAE-FVNWLLAGG---------
>user2_w100 weight: 0.3333 score: 0.0 eval: n/a prob: n/a identity: 0.3333 startpos: 1
-GDA-----------------YAQWLADGGPSSGRPPPS
>user3_w100 weight: 0.3333 score: 0.0 eval: n/a prob: n/a identity: 0.5641 startpos: 1
--------DLSKQLDEQCAKLFIEWLA-GGPSSGAPPPC
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington