2021-05-08_00000123_1_11 Domain 3 Parse 1 Confidence: 0.33
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 74872 | Complete | Structure prediction | cameo | 2021-05-08_00000123_1_11 | 1519 | 8 May 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 73171 | 3 | 1 | 0.33 | comparative modeling | 1459-1519 | 61 | 11 May 2021 |
>73171
EGNTKVNTLPNEVHELSLRLVKVGDASDSTGDHKVMSKNNSQALTASATPTKTTTPATAKA
>6vjbA_201 weight: 1.0000 score: 51.75 eval: 2e-07 prob: 93.64 identity: 0.4262 startpos: 1321
EGNTKVNTLPNEVHELSLRLVKVGDA-----------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington