2021-06-05_00000109_1_19 Domain 8 Parse 1 Confidence: 0.04
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 79727 | Complete | Structure prediction | RoseTTAFold | 2021-06-05_00000109_1_19 | 1319 | 5 Jun 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 77766 | 8 | 1 | 0.04 | comparative modeling | 1255-1319 | 65 | 6 Jun 2021 |
>77766
RRRHSSDDTLDNRREFPLPEGALNNEDAWQPLADADEEDYWEPNENYVGQRCLLEDESFVMAVKA
>2dduA_201 weight: 1.0000 score: 24.45 eval: 130 prob: 17.51 identity: 0.0923 startpos: 68
--YYTGDFEEWTRITIAIPRSLASSKTriQE------VPPFGLDGVYISEPCPSY----------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington