2021-07-03_00000164_1_11 Domain 2 Parse 1 Confidence: 0.45
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
88859 | Complete | Structure prediction | cameo | 2021-07-03_00000164_1_11 | 2210 | 3 Jul 2021 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
86624 | 2 | 1 | 0.45 | comparative modeling | 2158-2210 | 53 | 4 Jul 2021 |
>86624
LDKFGDWLEFSNFKVAFSRSLNDLLISDPQGQFRLKGVTCRPLKHKVEIKDID
>2ks0A_201 weight: 0.5428 score: 18.55 eval: 170 prob: 48.3 identity: 0.1698 startpos: 4
----RQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLG-LKAG-Q-VEVE
>3ipfA_302 weight: 0.4572 score: 7.08 eval: n/a prob: n/a identity: 0.1698 startpos: 1
---NRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLghLDLKAGQVEVE
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington