2021-08-21_00000149_1_11 Domain 1 Parse 1 Confidence: 0.07
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 114277 | Complete | Structure prediction | cameo | 2021-08-21_00000149_1_11 | 1496 | 21 Aug 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 110963 | 1 | 1 | 0.07 | comparative modeling | 1-111 | 111 | 22 Aug 2021 |
>110963
MSKEQLLIQRSSAAERCRRYRQKMSAEQRASDLERRRRLQQNVSEEQLLEKRRSEAEKQRRHRQKMSKDQRAFEVERRRWRRQNMSREQSSTSTTNTGRNCLLSKNGVHED
>3kowE_201 weight: 1.0000 score: 25.4 eval: 74 prob: 48.56 identity: 0.1351 startpos: 1
-------------------------------DFQQRRAHLANLSDEELQTRFWEMAEKIVDPLLDLGKKNTTPSIERSVLLRMGFSSLEA---------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2025 University of Washington