2021-10-23_00000091_1_19 Domain 4 Parse 1 Confidence: 0.06
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 142551 | Complete | Structure prediction | RoseTTAFold | 2021-10-23_00000091_1_19 | 1066 | 23 Oct 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 139155 | 4 | 1 | 0.06 | comparative modeling | 982-1066 | 85 | 24 Oct 2021 |
>139155
SGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEEDNGGSLEVLFQGPSSPSAWSHPQFEKGGGSGGGSGGSSAWSHPQFEK
>6u7iC_101 weight: 0.9631 score: 16.05 eval: 0.027 prob: n/a identity: 0.0588 startpos: 201
------------------IEDVTIVPAVDGTVQYAVKTTGSAPVRVTVLD-----------------------------------
>6u7iA_103 weight: 0.0369 score: 15.59 eval: 0.031 prob: n/a identity: 0.0588 startpos: 200
------------------IEDVTIVPAVDGTVQYAVKTTGSAPVRVTVLD-----------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington