2021-11-13_00000175_1_19 Domain 4 Parse 1 Confidence: 0.28
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 150144 | Error | Structure prediction | RoseTTAFold | 2021-11-13_00000175_1_19 | 2839 | 13 Nov 2021 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 147755 | 4 | 1 | 0.28 | comparative modeling | 423-479 | 57 | 17 Nov 2021 |
>147755
LDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKE
>6w09Q_301 weight: 1.0000 score: 6.99 eval: n/a prob: n/a identity: 0.0702 startpos: 13
CSQPPCTPCCYEKeeKTLRMLEDNVmlLQASLTCSPRRQRR----------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington