T9999s1 Domain 2 Parse 1 Confidence: 0.19
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
116 | Complete | Structure prediction | casp | T9999s1 | 285 | 21 Apr 2018 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
162 | 2 | 1 | 0.19 | comparative modeling | 115-164 | 50 | 22 Apr 2018 |
>162
AGIATGAVTVGNAWEAPVGALSKAKAAKQAIPTQTVKELDGLLQESKNIG
>4k1pC_102 weight: 0.6841 score: 20.57 eval: 0.065 prob: n/a identity: 0.0800 startpos: 267
--------TLLTDWKVLNNNMIQIQKNVEE-sSLLQKHFNQIKKVSDEMN
>3ph0A_305 weight: 0.3159 score: 6.38 eval: n/a prob: n/a identity: 0.1200 startpos: 5
LETRLSGADPVFARELHAQLVQALGDVKRRlwQQEADAIEAGLNIIEKIK
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington