2022-01-29_00000279_1_11 Domain 6 Parse 1 Confidence: 0.10
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 200291 | Complete | Structure prediction | cameo | 2022-01-29_00000279_1_11 | 1239 | 29 Jan 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 197286 | 6 | 1 | 0.10 | comparative modeling | 1162-1239 | 78 | 30 Jan 2022 |
>197286
GFSPSNKWDVSTAARMQQRRVISLMDDLMSESETFARSAHSNHSLLQQIRRSYVKARKRGDLHTVKALQLRLKGFFQI
>5lnkg_201 weight: 1.0000 score: 21.9 eval: 82 prob: 70.68 identity: 0.1923 startpos: 1
---TSVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHldISVKQGRDKVREMFKKNAHVTDPRVVDLLVIKGKM----
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington