T0952 Domain 1 Parse 1 Confidence: 0.69
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 139 | Complete | Structure prediction | casp | T0952 | 35 | 3 May 2018 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 207 | 1 | 1 | 0.69 | comparative modeling | 1-35 | 35 | 3 May 2018 |
>207
ENIEETITVMKKLEEPRQKVVLDTAKIQLKEQDEQ
>1t6oA_301 weight: 1.0000 score: 7.83 eval: n/a prob: n/a identity: 0.1714 startpos: 2
ASRSVIRSIIKslEEDRKRYLMTLLDddLAKFHQM
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington