T1027 Domain 1 Parse 1 Confidence: 0.00
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
26396 | Complete | Structure prediction | casp | T1027 | 168 | 20 May 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
25719 | 1 | 1 | 0.00 | comparative modeling | 1-168 | 168 | 20 May 2020 |
>25719
KPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPAIPRFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD
>2vxoA_201 weight: 1.0000 score: 30.63 eval: 160 prob: 28.98 identity: 0.0893 startpos: 582
-------QRSVV--IRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKkpGISRIMYDLTSKPPGTT-----------------------------------------------------------------------------------------------------
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington