T1030 Domain 2 Parse 1 Confidence: 0.45
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
26616 | Complete | Structure prediction | casp | T1030 | 273 | 22 May 2020 | - |
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
25975 | 2 | 1 | 0.45 | comparative modeling | 74-133 | 60 | 22 May 2020 |
>25975
ISPEVLEEYKEKIQRASTKSQVDEFVAEAKKVVNSNKETLVNQANGKKQEIAKLENLSND
>5vjuA_101 weight: 0.9502 score: 43.05 eval: 0.033 prob: n/a identity: 0.2000 startpos: 38
--IKQLREASEKARNPEKKSVLQKILEDEEKHIEL-HETLQQTGQEAQQLLQELQQTGQ-
>5vjsA_104 weight: 0.0279 score: 42.54 eval: 0.035 prob: n/a identity: 0.2000 startpos: 38
--IKQLREASEKARNPEKKSVLQKILEDEEKHIEL-LETLQQTGQEAQQLLQELQQTGQ-
>5xg2A_106 weight: 0.0219 score: 42.4 eval: 0.036 prob: n/a identity: 0.2167 startpos: 56
EARKSLYEGEARIKRAeeKERLKAEILTGEARLPgrAENLRRLVEEKRAEISELERRLS-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2024 University of Washington