2022-03-26_00000099_1_19 Domain 1 Parse 1 Confidence: 0.18
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 264488 | Complete | Structure prediction | RoseTTAFold | 2022-03-26_00000099_1_19 | 1179 | 26 Mar 2022 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 260330 | 1 | 1 | 0.18 | comparative modeling | 1-42 | 42 | 26 Mar 2022 |
>260330
DEDQVDPRLIDGKWSRDQYHVLFDSYRDNIAGKSFQNRLCLP
>7rd1L_301 weight: 1.0000 score: 12.21 eval: n/a prob: n/a identity: 0.1190 startpos: 1
DQDKYARPENDDQLCKN-VNPTFYLYNVAVVDEFMSMGVIEA
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington