T1031 Domain 1 Parse 1 Confidence: 0.32
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 27139 | Complete | Structure prediction | casp | T1031 | 95 | 25 May 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 26318 | 1 | 1 | 0.32 | comparative modeling | 1-95 | 95 | 25 May 2020 |
>26318
ACKIENIKYKGKEVESKLGSQLIDIFNDLDRAKEEYDKLSSPEFIAKFGDWINDEVERNVNEDGEPLLIQDVRQDSSKHYFFILKNGERFDLLTR
>6dftG_201 weight: 1.0000 score: 25.56 eval: 230 prob: 33.21 identity: 0.1579 startpos: 128
DCHFGNVRYNSSGVAslFSCVMRCLVKRLAEAQRKewAITPSTLWYMAGLWMADIFTEAlgksgVPIFSPSL-TDGDIMetAGDtvlLQLDLVA-
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington