T1033 Domain 1 Parse 1 Confidence: 0.08
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
| 27277 | Complete | Structure prediction | casp | T1033 | 100 | 26 May 2020 | - |
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
| 26405 | 1 | 1 | 0.08 | comparative modeling | 1-100 | 100 | 26 May 2020 |
>26405
EFDSFTSPDLTNEIKEITDQLSYYIYNKHFSSDFEQVEGAKLNIQNEISQFVKEGKAPVQAAYNKLQDPDIKDLLDYYDNIEKHSDEFESEIVKFFSEKK
>1dkgA_201 weight: 1.0000 score: 21.18 eval: 300 prob: 45.17 identity: 0.0900 startpos: 3
-----QVDPRDEKVANLEAQLA---------EAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVavkSMLDVVRK--
Powered by
MSAViewer
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington